PDB entry 1utc

View 1utc on RCSB PDB site
Description: clathrin terminal domain complexed with tlpwdlwtt
Deposited on 2003-12-08, released 2004-02-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-25, with a file datestamp of 2004-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19718
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utcA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utcA (A:)
    ilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpir
    rpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvt
    dnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamql
    ysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpf
    pkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgeti
    fvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utcB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utcB (B:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrn