PDB entry 1uta

View 1uta on RCSB PDB site
Description: solution structure of the c-terminal rnp domain from the divisome protein ftsn
Deposited on 2003-12-04, released 2004-09-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-24, with a file datestamp of 2004-09-24.
Experiment type: NMR45
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1utaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utaA (A:)
    ftsnkderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenad
    stlnrlkmaghtncirlaagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utaA (A:)
    kderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenadstln
    rlkmaghtncirlaagg