PDB entry 1uta

View 1uta on RCSB PDB site
Description: solution structure of the c-terminal rnp domain from the divisome protein ftsn
Class: cell division
Keywords: bacterial cell division protein, rnp domain, cell division, transmembrane, inner membrane, repeat
Deposited on 2003-12-04, released 2004-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsn
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utaA (A:)
    ftsnkderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenad
    stlnrlkmaghtncirlaagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utaA (A:)
    kderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenadstln
    rlkmaghtncirlaagg