PDB entry 1ut9

View 1ut9 on RCSB PDB site
Description: structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, family 9, cellobiohydrolase
Deposited on 2003-12-04, released 2004-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.14928
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT9 (0-608)
    Domains in SCOPe 2.06: d1ut9a1, d1ut9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut9A (A:)
    ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
    yvhwldfsdfategigyyfelptvnsptnyshpfdirkdiytqmkydalaffyhkrsgip
    iempyaggeqwtrpaghigiepnkgdtnvptwpqddeyagipqknytkdvtggwydagdh
    gkyvvnggiavwtlmnmyerakirgldnwgpyrdggmnipeqnngypdildearweieff
    kkmqvtekedpsiagmvhhkihdfrwtalgmlphedpqprylrpvstaatlnfaatlaqs
    arlwkdydptfaadclekaeiawqaalkhpdiyaeytpgsggpgggpynddyvgdefywa
    acelyvttgkdeyknylmnsphylempakmgenggangednglwgcftwgttqglgtitl
    alvenglpatdiqkarnniakaadrwlenieeqgyrlpikqaederggypwgsnsfilnq
    mivmgyaydftgdskyldgmfdgisyllgrnamdqsyvtgygerplqnphdrfwtpqtsk
    rfpapppgiisggpnsrfedptinaavkkdtppqkcfidhtdswstneitvnwnapfawv
    tayldqytd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut9A (A:)
    ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
    yvhwldfsdfategigyyfelptvnsptnyshpfdirkdiytqmkydalaffyhkrsgip
    iempyaggeqwtrpaghigiepnkgdtnvptwpqddeyagipqknytkdvtggwydagdh
    gkyvvnggiavwtlmnmyerakirgldnwgpyrdggmnipeqnngypdildearweieff
    kkmqvtekedpsiagmvhhkihdfrwtalgmlphedpqprylrpvstaatlnfaatlaqs
    arlwkdydptfaadclekaeiawqaalkhpdiyaeytpgsggpgggpynddyvgdefywa
    acelyvttgkdeyknylmnsphylempakmgangednglwgcftwgttqglgtitlalve
    nglpatdiqkarnniakaadrwlenieeqgyrlpikqaederggypwgsnsfilnqmivm
    gyaydftgdskyldgmfdgisyllgrnamdqsyvtgygerplqnphdrfwtpqtskrfpa
    pppgiisggpnsrfedptinaavkkdtppqkcfidhtdswstneitvnwnapfawvtayl
    dqytd