PDB entry 1ut8

View 1ut8 on RCSB PDB site
Description: divalent metal ions (zinc) bound to t5 5'-exonuclease
Class: hydrolase
Keywords: exonuclease, hydrolase, nuclease
Deposited on 2003-12-04, released 2004-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.235
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: BACTERIOPHAGE T5 [TaxId:10726]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT8
    • Uniprot P06229 (Start-290)
    Domains in SCOPe 2.07: d1ut8a1, d1ut8a2
  • Chain 'B':
    Compound: exodeoxyribonuclease
    Species: BACTERIOPHAGE T5 [TaxId:10726]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT8
    • Uniprot P06229 (Start-290)
    Domains in SCOPe 2.07: d1ut8b1, d1ut8b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut8A (A:)
    mskswgkfieeeeaemasrrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysa
    rttivlgdkgksvfrlehlpeykgnrdekyaqrteeekaldeqffeylkdafelckttfp
    tftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdm
    yehhnvddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkq
    kyiqnlnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut8A (A:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ut8B (B:)
    mskswgkfieeeeaemasrrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysa
    rttivlgdkgksvfrlehlpeykgnrdekyaqrteeekaldeqffeylkdafelckttfp
    tftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdm
    yehhnvddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkq
    kyiqnlnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut8B (B:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq