PDB entry 1ut7

View 1ut7 on RCSB PDB site
Description: structure of the conserved domain of anac, a member of the nac family of transcription factors
Class: transcription regulation
Keywords: transcription regulation, transcription, transcription factor, DNA binding, abscisic acid response, arabidopsis thaliana, crystal structure, nac domain
Deposited on 2003-12-04, released 2004-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: no apical meristem protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT7 (0-2)
    • Uniprot Q9C932 (3-End)
    Domains in SCOPe 2.07: d1ut7a_
  • Chain 'B':
    Compound: no apical meristem protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT7 (0-2)
    • Uniprot Q9C932 (3-End)
    Domains in SCOPe 2.07: d1ut7b_
  • Heterogens: AU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut7A (A:)
    gshmgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpw
    vlpnkalfgekewyffsprdrkypngsrpnrvagsgywkatgtdkiistegqrvgikkal
    vfyigkapkgtktnwimheyrliepsrrngstklddwvlcriykkqssaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut7A (A:)
    gshmgiqltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpwvlpn
    kalfgekewyffsprdrpnrvagsgywkatgtdkiistegqrvgikkalvfyigkapkgt
    ktnwimheyrliepsddwvlcriykkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ut7B (B:)
    gshmgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpw
    vlpnkalfgekewyffsprdrkypngsrpnrvagsgywkatgtdkiistegqrvgikkal
    vfyigkapkgtktnwimheyrliepsrrngstklddwvlcriykkqssaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut7B (B:)
    gshmgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpw
    vlpnkalfgekewyffsprdpnrvagsgywkatgtdkiistegqrvgikkalvfyigkap
    kgtktnwimheyrliepsddwvlcriykkq