PDB entry 1ut5

View 1ut5 on RCSB PDB site
Description: divalent metal ions (manganese) bound to t5 5'-exonuclease
Deposited on 2003-12-04, released 2004-02-05
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-23, with a file datestamp of 2004-04-23.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.252
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut5A (A:)
    mskswgkfieeeeaemasrrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysa
    rttivlgdkgksvfrlehlpeykgnrdekyaqrteeekaldeqffeylkdafelckttfp
    tftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdm
    yehhnvddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkq
    kyiqnlnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut5A (A:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ut5B (B:)
    mskswgkfieeeeaemasrrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysa
    rttivlgdkgksvfrlehlpeykgnrdekyaqrteeekaldeqffeylkdafelckttfp
    tftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdm
    yehhnvddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkq
    kyiqnlnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut5B (B:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq