PDB entry 1ut3

View 1ut3 on RCSB PDB site
Description: solution structure of spheniscin-2, a beta-defensin from penguin stomach preserving food
Class: antibiotic
Keywords: antimicrobial peptide, penguin, defensin, nmr structure, gastrointestinal immunity, antibiotic, fungicide
Deposited on 2003-12-02, released 2004-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2004-07-16, with a file datestamp of 2007-07-20.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: spheniscin-2
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83430 (0-37)
  Domains in SCOP 1.75: d1ut3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ut3A (A:)
  sfglcrlrrgfcargrcrfpsipigrcsrfvqccrrvw