PDB entry 1ut3

View 1ut3 on RCSB PDB site
Description: solution structure of spheniscin-2, a beta-defensin from penguin stomach preserving food
Class: antibiotic
Keywords: antimicrobial peptide, penguin, defensin, nmr structure, gastrointestinal immunity, antibiotic, fungicide
Deposited on 2003-12-02, released 2004-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spheniscin-2
    Species: APTENODYTES PATAGONICUS, synthetic [TaxId:9234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ut3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ut3A (A:)
    sfglcrlrrgfcargrcrfpsipigrcsrfvqccrrvw