PDB entry 1ut2

View 1ut2 on RCSB PDB site
Description: afae-3 adhesin from escherichia coli
Class: adhesin
Keywords: adhesin, afae-3, afimbrial adhesin, upec, daec
Deposited on 2003-12-02, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.228
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2a_
  • Chain 'B':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2b_
  • Chain 'C':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2c_
  • Chain 'D':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2d_
  • Chain 'E':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2e_
  • Chain 'F':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2f_
  • Chain 'G':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2g_
  • Chain 'H':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-148)
    Domains in SCOPe 2.07: d1ut2h_
  • Chain 'I':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT2
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-End)
    Domains in SCOPe 2.07: d1ut2i_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut2A (A:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2A (A:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqq
    tntppgnytltltggywa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ut2B (B:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2B (B:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ut2C (C:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2C (C:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ut2D (D:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2D (D:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ut2E (E:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2E (E:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ut2F (F:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2F (F:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ut2G (G:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2G (G:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ut2H (H:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2H (H:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywak
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ut2I (I:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut2I (I:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywa