PDB entry 1ut1

View 1ut1 on RCSB PDB site
Description: DraE adhesin from Escherichia Coli
Class: protein binding
Keywords: adhesin, protein binding fimbrial adhesin, upec, daec, protein binding
Deposited on 2003-12-02, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT1
      • engineered mutation (8-9)
      • engineered mutation (26)
    • Uniprot P24093 (8-147)
    Domains in SCOPe 2.07: d1ut1a_
  • Chain 'B':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT1
      • engineered mutation (8-9)
      • engineered mutation (26)
    • Uniprot P24093 (8-End)
    Domains in SCOPe 2.07: d1ut1b_
  • Chain 'C':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT1
      • engineered mutation (8-9)
      • engineered mutation (26)
    • Uniprot P24093 (8-End)
    Domains in SCOPe 2.07: d1ut1c_
  • Chain 'D':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT1
      • engineered mutation (8-9)
      • engineered mutation (26)
    • Uniprot P24093 (8-End)
    Domains in SCOPe 2.07: d1ut1d_
  • Chain 'E':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT1
      • engineered mutation (8-9)
      • engineered mutation (26)
    • Uniprot P24093 (8-147)
    Domains in SCOPe 2.07: d1ut1e_
  • Chain 'F':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UT1
      • engineered mutation (8-9)
      • engineered mutation (26)
    • Uniprot P24093 (8-End)
    Domains in SCOPe 2.07: d1ut1f_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut1A (A:)
    rghhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgc
    darqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggi
    igiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut1A (A:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ut1B (B:)
    rghhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgc
    darqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggi
    igiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut1B (B:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ut1C (C:)
    rghhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgc
    darqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggi
    igiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut1C (C:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ut1D (D:)
    rghhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgc
    darqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggi
    igiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut1D (D:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ut1E (E:)
    rghhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgc
    darqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggi
    igiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut1E (E:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ut1F (F:)
    rghhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgc
    darqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggi
    igiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut1F (F:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa