PDB entry 1ut0

View 1ut0 on RCSB PDB site
Description: crystal structure of cytoglobin: the fourth globin type discovered in man displays heme hexa-coordination
Class: oxygen transport
Keywords: oxygen transport, hemoglobin
Deposited on 2003-12-02, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21591
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d1ut0a_
  • Chain 'B':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d1ut0b_
  • Heterogens: HEM, FC6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ut0A (A:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut0A (A:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ut0B (B:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ut0B (B:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw