PDB entry 1usz

View 1usz on RCSB PDB site
Description: semet afae-3 adhesin from escherichia coli
Class: adhesin
Keywords: adhesin, afae-3, afimbrial adhesin, upec, daec
Deposited on 2003-12-02, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.28 Å
R-factor: 0.22
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USZ
      • engineered mutation (9-10)
    • Uniprot Q57254 (9-148)
    Domains in SCOPe 2.07: d1usza_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uszA (A:)
    rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
    cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
    tigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uszA (A:)
    gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
    adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
    qtntppgnytltltggywak