PDB entry 1usy

View 1usy on RCSB PDB site
Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima
Class: transferase
Keywords: transferase, ATP phosphoribosyl transferase, aminoacyl-tRNA synthetase
Deposited on 2003-12-01, released 2004-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.207
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usya_
  • Chain 'B':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usyb_
  • Chain 'C':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0D3 (0-274)
      • conflict (67)
      • conflict (133)
    Domains in SCOPe 2.07: d1usyc_
  • Chain 'D':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usyd_
  • Chain 'E':
    Compound: ATP phosphoribosyltransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usye_
  • Chain 'F':
    Compound: ATP phosphoribosyltransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usyf_
  • Chain 'G':
    Compound: ATP phosphoribosyltransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usyg_
  • Chain 'H':
    Compound: ATP phosphoribosyltransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0D2 (0-End)
      • conflict (185)
    Domains in SCOPe 2.07: d1usyh_
  • Heterogens: HIS, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1usyA (A:)
    mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
    hrkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
    fegpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
    edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
    iydtsssrlvaaggeytvngekgvggsiflegktc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1usyB (B:)
    mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
    hrkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
    fegpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
    edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
    iydtsssrlvaaggeytvngekgvggsiflegktc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1usyC (C:)
    mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
    hrkryspesqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
    fegpviveightglyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
    edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
    iydtsssrlvaaggeytvngekgvggsiflegktc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1usyD (D:)
    mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
    hrkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
    fegpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
    edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
    iydtsssrlvaaggeytvngekgvggsiflegktc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usyD (D:)
    dfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvlnh
    rkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesaseff
    egpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekiie
    dsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglifti
    ydtsssrlvaaggeytvngekgvggsiflegktc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1usyE (E:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkreevvsfleklqeviehdsneqsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usyE (E:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkreevvsfleklqeviehds
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1usyF (F:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkreevvsfleklqeviehdsneqsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usyF (F:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkreevvsfleklqeviehdsn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1usyG (G:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkreevvsfleklqeviehdsneqsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usyG (G:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkreevvsfleklqeviehdsne
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1usyH (H:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkrekvvsfleklqeviehdsneqsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usyH (H:)
    mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
    gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
    gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
    rtkrekvvsfleklqeviehds