PDB entry 1usx

View 1usx on RCSB PDB site
Description: crystal structure of the newcastle disease virus hemagglutinin- neuraminidase complexed with thiosialoside
Deposited on 2003-12-01, released 2004-03-19
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-26, with a file datestamp of 2004-03-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1usxa_
  • Chain 'B':
    Domains in SCOP 1.67: d1usxb_
  • Chain 'C':
    Domains in SCOP 1.67: d1usxc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usxA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usxA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1usxB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usxB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1usxC (C:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usxC (C:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndg