PDB entry 1usw

View 1usw on RCSB PDB site
Description: Crystal Structure of Ferulic Acid Esterase from Aspergillus niger
Class: hydrolase
Keywords: hydrolase, feruloyl esterase, degradation plant cell walls
Deposited on 2003-12-01, released 2004-04-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: feruloyl esterase a
    Species: ASPERGILLUS NIGER [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uswa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uswA (A:)
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppadegyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw