PDB entry 1usu

View 1usu on RCSB PDB site
Description: The Structure of the complex between Aha1 and HSP90
Class: chaperone
Keywords: chaperone-complex, chaperone, activator, hsp90
Deposited on 2003-12-01, released 2004-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hsp82
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USU (Start-1)
      • conflict (210)
    • Uniprot P02829 (2-End)
    Domains in SCOPe 2.08: d1usua_
  • Chain 'B':
    Compound: aha1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USU
      • conflict (41)
    • Uniprot Q12449
    Domains in SCOPe 2.08: d1usub_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usuA (A:)
    gptkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfd
    lfeskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimk
    virknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstks
    vdeltsltdyvtrmpehqkniyyitgeslksvekspfldalkaknfevlfltdpideyaf
    tqlkefegktlvditkdfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usuA (A:)
    ptkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdl
    fesnniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlqnkimkvirknivkkli
    eafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdyv
    trmpehqkniyyitgeslksvekspfldalkaknfevlfltdpideyaftqlkefegktl
    vditkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1usuB (B:)
    mrgshhhhhhgmasmvvnnpnnwhwvdkncigwakeyfkqkivgveagsvkdkkyakiks
    vssiegdcevnqrkgkvislfdlkitvlieghvdskdgsalpfegsinvpevafdseass
    yqfdisifketselseakplirsellpklrqifqqfgkdllathgndiqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usuB (B:)
    vdkncigwakeyfkqkivgveakkyakiksvssiegdcevnqrgkvislfdlkitvlieg
    hvdsalpfegsinvpevafdseassyqfdisifketselseakplirsellpklrqifqq
    fgkdllathgnd