PDB entry 1uss

View 1uss on RCSB PDB site
Description: yeast histone h1 globular domain II, hho1p gii, solution nmr structures
Class: DNA binding protein
Keywords: DNA binding protein, linker histone, DNA binding domain
Deposited on 2003-11-30, released 2004-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53551 (0-87)
  Domains in SCOPe 2.08: d1ussa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ussA (A:)
  kasspssltykemilksmpqlndgkgssrivlkkyvkdtfssklktssnfdylfnsaikk
  cvengelvqpkgpsgiiklnkkkvklst