PDB entry 1usq

View 1usq on RCSB PDB site
Description: complex of e. coli drae adhesin with chloramphenicol
Class: adhesin
Keywords: adhesin, drae, fimbrial adhesin, chloramphenicol, upec, daec
Deposited on 2003-11-27, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USQ
      • engineered mutation (9-10)
      • engineered mutation (27)
    • Uniprot P24093 (9-End)
    Domains in SCOPe 2.07: d1usqa_
  • Chain 'B':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USQ
      • engineered mutation (9-10)
      • engineered mutation (27)
    • Uniprot P24093 (9-End)
    Domains in SCOPe 2.07: d1usqb_
  • Chain 'C':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USQ
      • engineered mutation (9-10)
      • engineered mutation (27)
    • Uniprot P24093 (9-End)
    Domains in SCOPe 2.07: d1usqc_
  • Chain 'D':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USQ
      • engineered mutation (9-10)
      • engineered mutation (27)
    • Uniprot P24093 (9-End)
    Domains in SCOPe 2.07: d1usqd_
  • Chain 'E':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USQ
      • engineered mutation (9-10)
      • engineered mutation (27)
    • Uniprot P24093 (9-End)
    Domains in SCOPe 2.07: d1usqe_
  • Chain 'F':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USQ
      • engineered mutation (9-10)
      • engineered mutation (27)
    • Uniprot P24093 (9-148)
    Domains in SCOPe 2.07: d1usqf_
  • Heterogens: SO4, EDO, CLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usqA (A:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usqA (A:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1usqB (B:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usqB (B:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1usqC (C:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usqC (C:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1usqD (D:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usqD (D:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1usqE (E:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usqE (E:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1usqF (F:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usqF (F:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywak