PDB entry 1usp

View 1usp on RCSB PDB site
Description: organic hydroperoxide resistance protein from deinococcus radiodurans
Class: oxidoreductase
Keywords: oxidoreductase, 2-cys peroxidase
Deposited on 2003-11-27, released 2004-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RTA8 (Start-138)
      • conflict (68)
    Domains in SCOPe 2.07: d1uspa_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Domains in SCOPe 2.07: d1uspb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uspA (A:)
    manvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqg
    algvvsrrqkidvpadstitarvglqkaglafaldveleghfpglsreqaeglmhaahev
    cpysaatrnnvdvrlkvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uspA (A:)
    nvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqgal
    gvvsrrqkidvpadstitarvglqkaglafaldveleghfpglsreqaeglmhaahevcp
    ysaatrnnvdvrlkvre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uspB (B:)
    manvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqg
    algvvsrrnkidvpadstitarvglqkaglafaldveleghfpglsreqaeglmhaahev
    cpysaatrnnvdvrlkvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uspB (B:)
    anvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqga
    lgvvsrrnkidvpadstitarvglqkfaldveleghfpglsreqaeglmhaahevcpysa
    atrnnvdvrlkvre