PDB entry 1uso

View 1uso on RCSB PDB site
Description: dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant
Class: transcriptional stimulator
Keywords: transcriptional stimulator, dimerization cofactor, dehydratase, 4a-carbinolamine dehydratase, transregulator of homeodomain proteins, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-11-27, released 2003-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.216
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USO
    Domains in SCOPe 2.07: d1usoa_
  • Chain 'B':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USO (0-End)
    Domains in SCOPe 2.07: d1usob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1usoA (A:)
mdweerenpkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsa
ggvtekdremarltdallqr

    Sequence, based on observed residues (ATOM records): (download) 
    >1usoA (A:)
dweerenpkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsag
gvtekdremarltdallq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1usoB (B:)
mdweerenpkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsa
ggvtekdremarltdallqr

    Sequence, based on observed residues (ATOM records): (download) 
    >1usoB (B:)
mdweerenpkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsa
ggvtekdremarltdallq