PDB entry 1usm

View 1usm on RCSB PDB site
Description: dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant
Class: transcriptional stimulator
Keywords: transcriptional stimulator, dimerization cofactor, dehydratase, 4a-carbinolamine dehydratase, transregulator of homeodomain proteins, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-11-26, released 2003-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.215
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hepatocyte nuclear factor 1-alpha
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • PDB 1USM (0-79)
  Domains in SCOPe 2.07: d1usma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1usmA (A:)
  mdweerenlkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsa
  ggvtekdremarltdallqr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1usmA (A:)
  mdweerkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsaggv
  tekdremarltdallqr