PDB entry 1usm

View 1usm on RCSB PDB site
Description: dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant
Class: transcriptional stimulator
Keywords: transcriptional stimulator, dimerization cofactor, dehydratase, 4a-carbinolamine dehydratase, transregulator of homeodomain proteins, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-11-26, released 2003-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USM (0-79)
    Domains in SCOPe 2.08: d1usma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usmA (A:)
    mdweerenlkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsa
    ggvtekdremarltdallqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usmA (A:)
    mdweerkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsaggv
    tekdremarltdallqr