PDB entry 1usl

View 1usl on RCSB PDB site
Description: structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, complexed with phosphate.
Class: isomerase
Keywords: isomerase, phosphopentose isomerase b, pentose phosphate pathway, rv2465c, phosphoriboisomerase b, structural proteomics in europe, spine, structural genomics
Deposited on 2003-11-25, released 2004-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.17019
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose 5-phosphate isomerase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usla_
  • Chain 'B':
    Compound: Ribose 5-phosphate isomerase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uslb_
  • Chain 'C':
    Compound: Ribose 5-phosphate isomerase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uslc_
  • Chain 'D':
    Compound: Ribose 5-phosphate isomerase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usld_
  • Chain 'E':
    Compound: Ribose 5-phosphate isomerase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usle_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uslA (A:)
    mahhhhhhmsgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafcia
    aatrtvadpgslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligigg
    rmhtvaealaivdafvttpwskaqrhqrridilaeyertheappvpgapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uslA (A:)
    gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
    slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
    ivdafvttpwskaqrhqrridilaeyertheappvpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uslB (B:)
    mahhhhhhmsgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafcia
    aatrtvadpgslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligigg
    rmhtvaealaivdafvttpwskaqrhqrridilaeyertheappvpgapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uslB (B:)
    gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
    slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
    ivdafvttpwskaqrhqrridilaeyertheappvpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uslC (C:)
    mahhhhhhmsgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafcia
    aatrtvadpgslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligigg
    rmhtvaealaivdafvttpwskaqrhqrridilaeyertheappvpgapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uslC (C:)
    gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
    slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
    ivdafvttpwskaqrhqrridilaeyertheappvpgap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uslD (D:)
    mahhhhhhmsgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafcia
    aatrtvadpgslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligigg
    rmhtvaealaivdafvttpwskaqrhqrridilaeyertheappvpgapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uslD (D:)
    sgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadp
    gslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeal
    aivdafvttpwskaqrhqrridilaeyertheappvpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uslE (E:)
    mahhhhhhmsgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafcia
    aatrtvadpgslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligigg
    rmhtvaealaivdafvttpwskaqrhqrridilaeyertheappvpgapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uslE (E:)
    gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
    slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
    ivdafvttpwskaqrhqrridilaeyertheappvpg