PDB entry 1usk

View 1usk on RCSB PDB site
Description: l-leucine-binding protein with leucine bound
Class: transport protein
Keywords: leucine-binding protein, x-ray crystallography, protein structure, abc transport systems, transport protein
Deposited on 2003-11-25, released 2003-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine-specific binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOPe 2.07: d1uska_
  • Chain 'B':
    Compound: leucine-specific binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOPe 2.07: d1uskb_
  • Chain 'C':
    Compound: leucine-specific binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOPe 2.07: d1uskc_
  • Chain 'D':
    Compound: leucine-specific binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOPe 2.07: d1uskd_
  • Heterogens: LEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uskA (A:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uskB (B:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uskC (C:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uskD (D:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak