PDB entry 1usj

View 1usj on RCSB PDB site
Description: udp-galactopyranose mutase from klebsiella pneumoniae
Deposited on 2003-11-24, released 2004-12-15
The last revision was dated 2005-05-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactopyranose mutase
    Species: Klebsiella pneumoniae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48485
      • conflict (261)
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1usjA (A:)
    mkskkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygph
    ifhtdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearal
    iaekgdstiadpqtfeeqalrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfn
    yddnyfnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafy
    gyqygrlgyrtldfkkftyqgqyqgcavmnycsvdvpytritehkyfspweqhdgsvcyk
    eysraceendipyypirqmgemallekylslaenetnitfvgrlgtyryldmdvtiaeal
    ktaevylnsltenqpmpvftvsvr
    

    Sequence, based on observed residues (ATOM records):
    >1usjA (A:)
    skkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygphif
    htdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearalia
    ekgdsdpqtfeeqalrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfnyddny
    fnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafygyqyg
    rlgyrtldfkkftyqgqyqgcavmnycsvdvpytritehkyfspweqhdgsvcykeysra
    ceendipyypirqmgemallekylslaenetnitfvgrlgtyryldmdvtiaealktaev
    ylnslnqpmpvftvsv