PDB entry 1ush

View 1ush on RCSB PDB site
Description: 5'-nucleotidase from e. coli
Deposited on 1998-09-16, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ush_ (-)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkpgyvntgfidaevlkayiqksspldvsvyepkgevswq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ush_ (-)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkrvly
    tpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnmgrlilaaqmd
    rtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevidyltavaqmkp
    dsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdgyprldnkpgy
    vntgfidaevlkayiqksspldvsvyepkgevswq