PDB entry 1usd

View 1usd on RCSB PDB site
Description: human vasp tetramerisation domain l352m
Class: signaling protein
Keywords: signaling protein, phosphorylation, actin-binding, kinase
Deposited on 2003-11-21, released 2004-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vasodilator-stimulated phosphoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50552
      • engineered mutation (16)
    Domains in SCOPe 2.08: d1usda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usdA (A:)
    psssdysdlqrvkqelmeevkkelqkvkeeiieafvqelrkrgsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usdA (A:)
    ssdysdlqrvkqelmeevkkelqkvkeeiieafvqelrkrgs