PDB entry 1usc

View 1usc on RCSB PDB site
Description: putative styrene monooxygenase small component
Deposited on 2003-11-21, released 2003-11-27
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-27, with a file datestamp of 2003-11-27.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.203
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1usca_
  • Chain 'B':
    Domains in SCOP 1.67: d1uscb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uscA (A:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uscB (B:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap