PDB entry 1usc

View 1usc on RCSB PDB site
Description: putative styrene monooxygenase small component
Class: oxygenase
Keywords: oxygenase, fmn-binding protein, structural genomics, styrene monooxygenase, riken structural genomics/proteomics initiative, rsgi
Deposited on 2003-11-21, released 2003-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative styrene monooxygenase small component
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USC (0-177)
    Domains in SCOPe 2.08: d1usca_
  • Chain 'B':
    Compound: putative styrene monooxygenase small component
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USC (0-177)
    Domains in SCOPe 2.08: d1uscb_
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uscA (A:)
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uscB (B:)
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap