PDB entry 1usb

View 1usb on RCSB PDB site
Description: rational design of a novel enzyme - efficient thioester hydrolysis enabled by the incorporation of a single his residue into human glutathione transferase a1-1
Class: transferase
Keywords: transferase, glutathione
Deposited on 2003-11-20, released 2004-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USB
      • engineered mutation (218)
    • Uniprot P08263 (4-End)
    Domains in SCOPe 2.06: d1usba1, d1usba2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USB
      • engineered mutation (218)
    • Uniprot P08263 (4-End)
    Domains in SCOPe 2.06: d1usbb1, d1usbb2
  • Heterogens: GSH, CL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usbA (A:)
    gstaaekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpm
    veidgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeek
    daklalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldssliss
    fpllkalktrisnlptvkkflqpgsprkppmdeksleehrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usbA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleehrkifr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1usbB (B:)
    gstaaekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpm
    veidgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeek
    daklalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldssliss
    fpllkalktrisnlptvkkflqpgsprkppmdeksleehrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usbB (B:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleehrkif