PDB entry 1us8

View 1us8 on RCSB PDB site
Description: the rad50 signature motif: essential to ATP binding and biological function
Class: DNA repair
Keywords: DNA repair, abc ATPase, signature motif
Deposited on 2003-11-20, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA double-strand break repair rad50 ATPase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1us8.1
  • Chain 'B':
    Compound: DNA double-strand break repair rad50 ATPase
    Species: Pyrococcus furiosus [TaxId:2261]
    Domains in SCOPe 2.07: d1us8.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1us8A (A:)
    mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplrikdikkde
    ftkvgardtyidlifekdgtkyritrrflkgyssgeihamkrlvgnewkhvtepsskais
    afmeklipyniflnaiyirqgqidail
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us8A (A:)
    mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplridtyidli
    fekdgtkyritrrflsgeihamkrlvgnewkhvtepsskaisafmeklipyniflnaiyi
    rqgqidail
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1us8B (B:)
    lareaalskigelaseifaeftegkysevvvraeenkvrlfvvwegkerpltflrggeri
    alglafrlamslylageisllildeptpyldeerrrklitimerylkkipqvilvshdee
    lkdaadhvirislengsskvevvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us8B (B:)
    lareaalskigelaseifaeftegkysevvvravrlfvvwegkerpltflrggerialgl
    afrlamslylageisllildeptpyldeerrrklitimerylkkipqvilvshdeelkda
    adhvirislengsskvevvs