PDB entry 1us6

View 1us6 on RCSB PDB site
Description: crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution
Class: transcription repressor
Keywords: transcription repressor, negative regulator, quorum-sensing, conjugation, transcripti regulation, repressor, plasmid.
Deposited on 2003-11-18, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional repressor tram
    Species: AGROBACTERIUM TUMEFACIENS, synthetic [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1us6a_
  • Chain 'B':
    Compound: transcriptional repressor tram
    Species: AGROBACTERIUM TUMEFACIENS, synthetic [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1us6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1us6A (A:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlysilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us6A (A:)
    velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
    yieasiemhaqmsalntlysilgfipkvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1us6B (B:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlysilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us6B (B:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlysilgfipkvv