PDB entry 1us5

View 1us5 on RCSB PDB site
Description: putative glur0 ligand binding core with l-glutamate
Deposited on 2003-11-18, released 2003-11-19
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-19, with a file datestamp of 2003-11-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1us5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1us5A (A:)
    mrkpilaaltlaglglaqefitigsgsttgvyfpvatgiaklvndanvgiranarstggs
    vaninainagefemalaqndiayyayqgccipafegkpvktiralaalypevvhvvarkd
    agirtvadlkgkrvvvgdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkr
    adalfytvglgasaiqqlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvt
    tptvavqamliaserlseetvykfmkavfgnleafkkihpnlerffglekavkglpiplh
    pgaerfykeagvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us5A (A:)
    aqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninainagefemal
    aqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvv
    gdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiq
    qlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserl
    seetvykfmkavfgnleafkkihpnlerffglekavkglpiplhpgaerfykeagvlk