PDB entry 1us2

View 1us2 on RCSB PDB site
Description: xylanase10c (mutant e385a) from cellvibrio japonicus in complex with xylopentaose
Class: hydrolase
Keywords: hydrolase, carbohydrate binding module, xylan degradation
Deposited on 2003-11-17, released 2003-12-18
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18135
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-xylanase
    Species: Cellvibrio japonicus
    Database cross-references and differences (RAF-indexed):
    • PDB 1US2
      • see remark 999 (101)
      • see remark 999 (451)
      • see remark 999 (509)
      • engineered mutation (300)
    • Uniprot Q59675 (Start-521)
    Domains in SCOP 1.73: d1us2a1, d1us2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1us2A (A:)
    mvaasegnvvievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttl
    edaviamvvnvsaefkaseanlqifaqlkedwskgewdclaasseltadtdltltctide
    dddkfnqtardvqvgiqakgtpagtitiksvtitlaqeaysanvdhlrdlapsdfpigva
    vsntdsatynlltnsreqavvkkhfnhltagnimkmsymqptegnfnftnadafvdwate
    nnmtvhghalvwhsdyqvpnfmknwagsaedflaaldthittivdhyeakgnlvswdvvn
    aaiddnspanfrttdsafyvksgnssvyierafqtaraadpavilyyndynieqnnaktt
    kmvdmvkdfqarsipidgvgfqmhvcmnypsianisaamkkvvdlgllvkiteldvavnq
    phcdaypankinplteaaqlaqkkrycdvvkayldtvpvnqrggisvwgttdantwldgl
    yreqfedekiswpllfdnnyndkpalrgfadaligtqctnthelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us2A (A:)
    ievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledaviamvvn
    vsaefkaseanlqifaqlkedwskgewdclaasselttdltltctidedddkfnqtardv
    qvgiqakgtpagtitiksvtitlaysanvdhlrdlapsdfpigvavsntdsatynlltns
    reqavvkkhfnhltagnimkmsymqptegnfnftnadafvdwatennmtvhghalvwhsd
    yqvpnfmknwagsaedflaaldthittivdhyeakgnlvswdvvnaaiddnspanfrttd
    safyvksgnssvyierafqtaraadpavilyyndynieqnnakttkmvdmvkdfqarsip
    idgvgfqmhvcmnypsianisaamkkvvdlgllvkiteldvavnqphcdaypankinplt
    eaaqlaqkkrycdvvkayldtvpvnqrggisvwgttdantwldglyreqfedekiswpll
    fdnnyndkpalrgfadaligtqctnth