PDB entry 1us2

View 1us2 on RCSB PDB site
Description: Xylanase10C (mutant E385A) from Cellvibrio japonicus in complex with xylopentaose
Class: hydrolase
Keywords: hydrolase, carbohydrate binding module, xylan degradation
Deposited on 2003-11-17, released 2003-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-xylanase
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59675 (Start-521)
      • see remark 999 (101)
      • see remark 999 (451)
      • see remark 999 (509)
      • engineered mutation (300)
    Domains in SCOPe 2.08: d1us2a1, d1us2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1us2A (A:)
    mvaasegnvvievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttl
    edaviamvvnvsaefkaseanlqifaqlkedwskgewdclaasseltadtdltltctide
    dddkfnqtardvqvgiqakgtpagtitiksvtitlaqeaysanvdhlrdlapsdfpigva
    vsntdsatynlltnsreqavvkkhfnhltagnimkmsymqptegnfnftnadafvdwate
    nnmtvhghalvwhsdyqvpnfmknwagsaedflaaldthittivdhyeakgnlvswdvvn
    aaiddnspanfrttdsafyvksgnssvyierafqtaraadpavilyyndynieqnnaktt
    kmvdmvkdfqarsipidgvgfqmhvcmnypsianisaamkkvvdlgllvkiteldvavnq
    phcdaypankinplteaaqlaqkkrycdvvkayldtvpvnqrggisvwgttdantwldgl
    yreqfedekiswpllfdnnyndkpalrgfadaligtqctnthelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us2A (A:)
    ievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledaviamvvn
    vsaefkaseanlqifaqlkedwskgewdclaasselttdltltctidedddkfnqtardv
    qvgiqakgtpagtitiksvtitlaysanvdhlrdlapsdfpigvavsntdsatynlltns
    reqavvkkhfnhltagnimkmsymqptegnfnftnadafvdwatennmtvhghalvwhsd
    yqvpnfmknwagsaedflaaldthittivdhyeakgnlvswdvvnaaiddnspanfrttd
    safyvksgnssvyierafqtaraadpavilyyndynieqnnakttkmvdmvkdfqarsip
    idgvgfqmhvcmnypsianisaamkkvvdlgllvkiteldvavnqphcdaypankinplt
    eaaqlaqkkrycdvvkayldtvpvnqrggisvwgttdantwldglyreqfedekiswpll
    fdnnyndkpalrgfadaligtqctnth