PDB entry 1us1

View 1us1 on RCSB PDB site
Description: crystal structure of human vascular adhesion protein-1
Deposited on 2003-11-17, released 2005-02-16
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane copper amine oxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: membrane copper amine oxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, CA, NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1us1A (A:)
    mnqktilvllilavitifalvcvllvgrggdggepsqlphcpsvspsaqpwthpgqsqlf
    adlsreeltavmrfltqrlgpglvdaaqarpsdncvfsvelqlppkaaalahldrgsppp
    arealaivffgrqpqpnvselvvgplphpsymrdvtverhggplpyhrrpvlfqeyldid
    qmifnrelpqasgllhhccfykhrgrnlvtmttaprglqsgdratwfglyynisgagffl
    hhvglellvnhkaldparwtiqkvfyqgryydslaqleaqfeaglvnvvlipdngtggsw
    slkspvppgpapplqfypqgprfsvqgsrvasslwtfsfglgafsgprifdvrfqgerlv
    yeislqealaiyggnspaamttryvdggfgmgkyttpltrgvdcpylatyvdwhfllesq
    apktirdafcvfeqnqglplrrhhsdlyshyfgglaetvlvvrsmstllnydyvwdtvfh
    psgaieirfyatgyissaflfgatgkygnqvsehtlgtvhthsahfkvdldvaglenwvw
    aedmvfvpmavpwspehqlqrlqvtrkllemeeqaaflvgsatprylylasnhsnkwghp
    rgyriqmlsfageplpqnssmargfsweryqlavtqrkeeepssssvfnqndpwaptvdf
    sdfinnetiagkdlvawvtagflhiphaedipntvtvgngvgfflrpynffdedpsfysa
    dsiyfrgdqdagacevnplaclpqaaacapdlpafshggfshn
    

    Sequence, based on observed residues (ATOM records):
    >1us1A (A:)
    gqsqlfadlsreeltavmrfltqrlgpglvdaaqarpsdncvfsvelqlppkaaalahld
    rgsppparealaivffgrqpqpnvselvvgplphpsymrdvtverhggplpyhrrpvlfq
    eyldidqmifnrelpqasgllhhccfygrnlvtmttaprglqsgdratwfglyynisgag
    fflhhvglellvnhkaldparwtiqkvfyqgryydslaqleaqfeaglvnvvlipdngtg
    gswslkspvppgpapplqfypqgprfsvqgsrvasslwtfsfglgafsgprifdvrfqge
    rlvyeislqealaiyggnspaamttryvdggfgmgkyttpltrgvdcpylatyvdwhfll
    esqapktirdafcvfeqnqglplrrhhsdlyshyfgglaetvlvvrsmstllnydyvwdt
    vfhpsgaieirfyatgyissaflfgatgkygnqvsehtlgtvhthsahfkvdldvaglen
    wvwaedmvfvpmavpwspehqlqrlqvtrkllemeeqaaflvgsatprylylasnhsnkw
    ghprgyriqmlsfageplpqnssmargfsweryqlavtqrkeeepssssvfnqndpwapt
    vdfsdfinnetiagkdlvawvtagflhiphaedipntvtvgngvgfflrpynffdedpsf
    ysadsiyfrgdqdagacevnplaclpqaaacapdlpafshggfs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1us1B (B:)
    mnqktilvllilavitifalvcvllvgrggdggepsqlphcpsvspsaqpwthpgqsqlf
    adlsreeltavmrfltqrlgpglvdaaqarpsdncvfsvelqlppkaaalahldrgsppp
    arealaivffgrqpqpnvselvvgplphpsymrdvtverhggplpyhrrpvlfqeyldid
    qmifnrelpqasgllhhccfykhrgrnlvtmttaprglqsgdratwfglyynisgagffl
    hhvglellvnhkaldparwtiqkvfyqgryydslaqleaqfeaglvnvvlipdngtggsw
    slkspvppgpapplqfypqgprfsvqgsrvasslwtfsfglgafsgprifdvrfqgerlv
    yeislqealaiyggnspaamttryvdggfgmgkyttpltrgvdcpylatyvdwhfllesq
    apktirdafcvfeqnqglplrrhhsdlyshyfgglaetvlvvrsmstllnydyvwdtvfh
    psgaieirfyatgyissaflfgatgkygnqvsehtlgtvhthsahfkvdldvaglenwvw
    aedmvfvpmavpwspehqlqrlqvtrkllemeeqaaflvgsatprylylasnhsnkwghp
    rgyriqmlsfageplpqnssmargfsweryqlavtqrkeeepssssvfnqndpwaptvdf
    sdfinnetiagkdlvawvtagflhiphaedipntvtvgngvgfflrpynffdedpsfysa
    dsiyfrgdqdagacevnplaclpqaaacapdlpafshggfshn
    

    Sequence, based on observed residues (ATOM records):
    >1us1B (B:)
    sqlfadlsreeltavmrfltqrlgpglvdaaqarpsdncvfsvelqlppkaaalahldrg
    sppparealaivffgrqpqpnvselvvgplphpsymrdvtverhggplpyhrrpvlfqey
    ldidqmifnrelpqasgllhhccfykrgrnlvtmttaprglqsgdratwfglyynisgag
    fflhhvglellvnhkaldparwtiqkvfyqgryydslaqleaqfeaglvnvvlipdngtg
    gswslkspvppgpapplqfypqgprfsvqgsrvasslwtfsfglgafsgprifdvrfqge
    rlvyeislqealaiyggnspaamttryvdggfgmgkyttpltrgvdcpylatyvdwhfll
    esqapktirdafcvfeqnqglplrrhhsdlyshyfgglaetvlvvrsmstllnydyvwdt
    vfhpsgaieirfyatgyissaflfgatgkygnqvsehtlgtvhthsahfkvdldvaglen
    wvwaedmvfvpmavpwspehqlqrlqvtrkllemeeqaaflvgsatprylylasnhsnkw
    ghprgyriqmlsfageplpqnssmargfsweryqlavtqrkeeepssssvfnqndpwapt
    vdfsdfinnetiagkdlvawvtagflhiphaedipntvtvgngvgfflrpynffdedpsf
    ysadsiyfrgdqdagacevnplacacapdlpafshggfs