PDB entry 1urz

View 1urz on RCSB PDB site
Description: low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
Class: virus/viral protein
Keywords: envelope protein, membrane fusion, virus/viral protein
Deposited on 2003-11-16, released 2004-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: TICK-BORNE ENCEPHALITIS VIRUS [TaxId:11088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urza1, d1urza2
  • Chain 'B':
    Compound: envelope protein
    Species: TICK-BORNE ENCEPHALITIS VIRUS [TaxId:11088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urzb1, d1urzb2
  • Chain 'C':
    Compound: envelope protein
    Species: TICK-BORNE ENCEPHALITIS VIRUS [TaxId:11088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urzc1, d1urzc2
  • Chain 'D':
    Compound: envelope protein
    Species: TICK-BORNE ENCEPHALITIS VIRUS [TaxId:11088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urzd1, d1urzd2
  • Chain 'E':
    Compound: envelope protein
    Species: TICK-BORNE ENCEPHALITIS VIRUS [TaxId:11088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urze1, d1urze2
  • Chain 'F':
    Compound: envelope protein
    Species: TICK-BORNE ENCEPHALITIS VIRUS [TaxId:11088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urzf1, d1urzf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urzA (A:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urzA (A:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
    eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
    laqtvileldptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmdvynlgd
    qtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkftwkrapt
    dsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfiemqlppg
    dniiyvgelshqwfqkgssigr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1urzB (B:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urzB (B:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
    eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
    laqtvileldktvehptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmdv
    ynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkftw
    kraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfiem
    qlppgdniiyvgelshqwfqkgssigr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1urzC (C:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urzC (C:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
    eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
    laqtvileldktlptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmdvyn
    lgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkftwkr
    aptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfiemql
    ppgdniiyvgelshqwfqkgssigr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1urzD (D:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urzD (D:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
    eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
    laqtvileldktveptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmdvy
    nlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkftwk
    raptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfiemq
    lppgdniiyvgelshqwfqkgssigr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1urzE (E:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urzE (E:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
    eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
    laqtvileldptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmdvynlgd
    qtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkftwkrapt
    dsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfiemqlppg
    dniiyvgelshqwfqkgssigr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1urzF (F:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urzF (F:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
    eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
    laqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmd
    vynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkft
    wkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfie
    mqlppgdniiyvgelshqwfqkgssigr