PDB entry 1urx

View 1urx on RCSB PDB site
Description: crystallographic structure of beta-agarase a in complex with oligoagarose
Deposited on 2003-11-12, released 2004-03-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-08, with a file datestamp of 2004-04-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.15642
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1urxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urxA (A:)
    mdiaqdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgp
    gstifnapqawtngsqlaiqaqpagngksyngiitsknkiqypvymeikakimdqvlana
    fwtltddetqsidimegygsdrggtwfaqrmhlshhtfirnpftdyqpmgdatwyynggt
    pwrsayhrygcywkdpftleyyidgvkvrtvtraeidpnnhlggtglnqatniiidcenq
    tdwrpaatqeeladdsknifwvdwirvykpvavslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urxA (A:)
    qdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgpgsti
    fnapqawtngsqlaiqaqpagngksyngiitsknkiqypvymeikakimdqvlanafwtl
    tddetqsidimegygsdrggtwfaqrmhlshhtfirnpftdyqpmgdatwyynggtpwrs
    ayhrygcywkdpftleyyidgvkvrtvtraeidpnnhlggtglnqatniiidcenqtdwr
    paatqeeladdsknifwvdwirvykpva