PDB entry 1urx

View 1urx on RCSB PDB site
Description: crystallographic structure of beta-agarase a in complex with oligoagarose
Class: hydrolase
Keywords: hydrolase, beta-agarase, agarose, glycoside hydrolase, family 16, double helix, two binding-sites
Deposited on 2003-11-12, released 2004-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.15642
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-agarase A
    Species: ZOBELLIA GALACTANIVORANS [TaxId:63186]
    Database cross-references and differences (RAF-indexed):
    • PDB 1URX
      • conflict (67)
      • engineered mutation (130)
    • Uniprot Q9RGX9
    Domains in SCOPe 2.07: d1urxa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urxA (A:)
    mdiaqdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgp
    gstifnapqawtngsqlaiqaqpagngksyngiitsknkiqypvymeikakimdqvlana
    fwtltddetqsidimegygsdrggtwfaqrmhlshhtfirnpftdyqpmgdatwyynggt
    pwrsayhrygcywkdpftleyyidgvkvrtvtraeidpnnhlggtglnqatniiidcenq
    tdwrpaatqeeladdsknifwvdwirvykpvavslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urxA (A:)
    qdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgpgsti
    fnapqawtngsqlaiqaqpagngksyngiitsknkiqypvymeikakimdqvlanafwtl
    tddetqsidimegygsdrggtwfaqrmhlshhtfirnpftdyqpmgdatwyynggtpwrs
    ayhrygcywkdpftleyyidgvkvrtvtraeidpnnhlggtglnqatniiidcenqtdwr
    paatqeeladdsknifwvdwirvykpva