PDB entry 1urt

View 1urt on RCSB PDB site
Description: murine carbonic anhydrase v
Deposited on 1996-07-03, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.137
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1urt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1urt_ (-)
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntghafqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgdfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr