PDB entry 1urr

View 1urr on RCSB PDB site
Description: A novel Drosophila Melanogaster Acylphosphatase (AcPDro2)
Deposited on 2003-11-03, released 2004-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-27, with a file datestamp of 2004-05-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1urra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urrA (A:)
    magsgvakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmm
    nlmemkhwlennripnakvskaefsqiqeiedytftsfdikh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urrA (A:)
    vakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmmnlmem
    khwlennripnakvskaefsqiqeiedytftsfdikh