PDB entry 1urp

View 1urp on RCSB PDB site
Description: d-ribose-binding protein from escherichia coli
Class: transport
Keywords: transport, chemotaxis, periplasm
Deposited on 1998-04-03, released 1998-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-ribose-binding protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1urpa_
  • Chain 'B':
    Compound: d-ribose-binding protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1urpb_
  • Chain 'C':
    Compound: d-ribose-binding protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1urpc_
  • Chain 'D':
    Compound: d-ribose-binding protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1urpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urpA (A:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urpB (B:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urpC (C:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urpD (D:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq