PDB entry 1urn

View 1urn on RCSB PDB site
Description: u1a mutant/RNA complex + glycerol
Class: transcription/RNA
Keywords: protein-RNA complex, single strand, overhanging base, hairpin loop, transcription-RNA complex
Deposited on 1995-01-04, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (u1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-End)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.07: d1urna_
  • Chain 'B':
    Compound: protein (u1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-End)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.07: d1urnb_
  • Chain 'C':
    Compound: protein (u1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-End)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.07: d1urnc_
  • Chain 'P':
    Compound: RNA (5'-r(*ap*ap*up*cp*cp*ap*up*up*gp*cp*ap*cp*up*cp*cp*gp*g p*ap*up*up*u)-3')
  • Chain 'Q':
    Compound: RNA (5'-r(*ap*ap*up*cp*cp*ap*up*up*gp*cp*ap*cp*up*cp*cp*gp*g p*ap*up*up*u)-3')
  • Chain 'R':
    Compound: RNA (5'-r(*ap*ap*up*cp*cp*ap*up*up*gp*cp*ap*cp*up*cp*cp*gp*g p*ap*up*up*u)-3')
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urnA (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urnA (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1urnB (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urnB (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1urnC (C:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urnC (C:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.