PDB entry 1urm

View 1urm on RCSB PDB site
Description: human peroxiredoxin 5, c47s mutant
Class: antioxidant enzyme
Keywords: antioxidant enzyme, peroxiredoxin, thioredoxin peroxidase, thioredoxin fold
Deposited on 2003-10-31, released 2004-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxiredoxin 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1URM (Start-10)
      • engineered mutation (57)
    • Uniprot P30044 (11-171)
    Domains in SCOPe 2.07: d1urma1, d1urma2
  • Heterogens: BEZ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urmA (A:)
    rgshhhhhhgsapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgssk
    thlpgfveqaealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketd
    lllddslvsifgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urmA (A:)
    sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgsskthlpgfveqa
    ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi
    fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql