PDB entry 1url

View 1url on RCSB PDB site
Description: n-terminal domain of sialoadhesin (mouse) in complex with glycopeptide
Class: sugar binding protein/immune system
Keywords: LECTIN/IG-DOMAIN, SIALOADHESIN, OLIGOSACCHARIDE MIMICS, MOLECULAR MIMICRY, CELL ADHESION, LECTIN, IMMUNOGLOBULIN DOMAIN, SUGAR BINDING PROTEIN IMMUNE SYSTEM COMPLEX, SUGAR BINDING PROTEIN, IMMUNE SYSTEM, SUGAR BINDING PROTEIN-IMMUNE SYSTEM complex
Deposited on 2003-10-31, released 2004-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialoadhesin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1urla_
  • Chain 'B':
    Compound: ala-gly-his-thr-trp-gly-hia
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1URL (Start-6)
  • Heterogens: SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urlA (A:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt
    

  • Chain 'B':
    No sequence available.