PDB entry 1urk

View 1urk on RCSB PDB site
Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator
Class: plasminogen activation
Keywords: plasminogen activation
Deposited on 1994-01-10, released 1995-05-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1urka1, d1urka2
  • Heterogens: FUC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urkA (A:)
    qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrgkastd
    tmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglkplvqe
    cmvhdcadgk