PDB entry 1urk

View 1urk on RCSB PDB site
Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator
Deposited on 1994-01-10, released 1995-05-08
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-08, with a file datestamp of 1995-06-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1urk_1, d1urk_2

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1urk_ (-)
  qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrgkastd
  tmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglkplvqe
  cmvhdcadgk