PDB entry 1urj

View 1urj on RCSB PDB site
Description: single stranded DNA-binding protein(icp8) from herpes simplex virus-1
Class: DNA-binding protein
Keywords: DNA-binding protein, ssb, icp8, hsv-1, DNA-binding, DNA replication, zinc-finger, nuclear protein.
Deposited on 2003-10-30, released 2004-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major DNA-binding protein
    Species: HUMAN HERPESVIRUS 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04296
      • engineered mutation (253)
      • engineered mutation (454)
    Domains in SCOPe 2.07: d1urja_
  • Chain 'B':
    Compound: major DNA-binding protein
    Species: HUMAN HERPESVIRUS 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04296
      • engineered mutation (253)
      • engineered mutation (454)
    Domains in SCOPe 2.07: d1urjb_
  • Heterogens: ZN, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urjA (A:)
    metkpktattikvppgplgyvyaracpsegiellallsarsgdsdvavaplvvgltvesg
    feanvavvvgsrttglggtavslkltpshysssvyvfhggrhldpstqapnltrlcerar
    rhfgfsdytprpgdlkhettgealcerlgldpdrallylvvtegfkeavcinntflhlgg
    sdkvtiggaevhripvyplqlfmpdfsrviaepfnanhrsigekftyplpffnrplnrll
    feavvgpaavalrsrnvdavaraaahlafdenhegaalpaditftafeasqgktprggrd
    gggkgaaggfeqrlasvmagdaalalesivsmavfdepptdisawplfegqdtaaarana
    vgaylaraaglvgamvfstnsalhltevddagpadpkdhskpsfyrfflvpgthvaanpq
    vdreghvvpgfegrptaplvggtqefagehlamlsgfspallakmlfylercdgavivgr
    qemdvfryvadsnqtdvpcnlctfdtrhacvhttlmrlrarhpkfasaargaigvfgtmn
    smysdcdvlgnyaafsalkradgsetartimqetyraatervmaeletlqyvdqavptam
    grletiitnrealhtvvnnvrqvvdreveqlmrnlvegrnfkfrdglgeanhamsltldp
    yacgpcpllqllgrrsnlavyqdlalsqchgvfagqsvegrnfrnqfqpvlrrrvmdmfn
    ngflsaktltvalsegaaicapsltagqtapaessfegdvarvtlgfpkelrvksrvlfa
    gasanaseaakarvaslqsayqkpdkrvdillgplgfllkqfhaaifpngkppgsnqpnp
    qwfwtalqrnqlparllsredietiafikkfsldygainfinlapnnvselamyymanqi
    lrycdhstyfintltaiiagsrrppsvqaaaawsaqggagleagaralmdavdahpgawt
    smfascnllrpvmaarpmvvlglsiskyygmagndrvfqagnwaslmggknacpllifdr
    trkfvlacpragfvcaasslgggahesslceqlrgiiseggaavassvfvatvkslgprt
    qqlqiedwlalledeylseemmeltaralergngewstdaalevaheaealvsqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urjA (A:)
    ttikvppgplgyvyaracpsegiellallsarsgdsdvavaplvvgltvesgfeanvavv
    vgsrttavslkltpshysssvyvfhggrhldpstqapnltrlcerarrhfgfsdytprpg
    dlkhettgealcerlgldpdrallylvvtegfkeavcinntflhlggsdkvtiggaevhr
    ipvyplqlfmpdfsrviaepfnanhrsigekftyplpffnrplnrllfeavvgpaavalr
    srnvdavaraaahlafdenhegaalpaditftafaggfeqrlasvmagdaalalesivsm
    avfdepptdisawplfegqdtaaaranavgaylaraaglvgamvfstnsalhltevddag
    pahskpsfyrfflvpgthvaanpqvdreghvvpgfegrptaplvggtqefagehlamlsg
    fspallakmlfylercdgavivmdvfryvadsnqtdvpcnlctfdtrhacvhttlmrlra
    rhpkfasaargaigvfgtmnsmysdcdvlgnyaetyraatervmaeletlqyvdqavpta
    mgrletiitnrealhtvvnnvrqvvdreveqlmrnlvefkfrdglgeanhamsltldpya
    cgpcpllqllgrrsnlavyqdlalsqchgvfagqsvegrnfrnqfqpvlrrrvmdmfnng
    flsaktltvalsaicapsltagqtapaessfegdvarvtlgfpkelrvksrvlfsayqkp
    dkrvdillgplgfllkqfhaaifpngkppgsnqpnpqwfwtalqrnqlparllsrediet
    iafikkfsldygainfinlapnnvselamyymanqilrycdhstyfintltaiiagsrrp
    psvqaaaawsaqggagleagaralmdavdahpgawtsmfascnllrpvmaarpmvvlgls
    iskyvfqagnwaslmggknacpllifdrtrkfvlacpragfvcaasslceqlrgiisegg
    aavassvfvatvkslgprtqqlqiedwlalledeylseemmeltaralergngewstdaa
    levaheaea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1urjB (B:)
    metkpktattikvppgplgyvyaracpsegiellallsarsgdsdvavaplvvgltvesg
    feanvavvvgsrttglggtavslkltpshysssvyvfhggrhldpstqapnltrlcerar
    rhfgfsdytprpgdlkhettgealcerlgldpdrallylvvtegfkeavcinntflhlgg
    sdkvtiggaevhripvyplqlfmpdfsrviaepfnanhrsigekftyplpffnrplnrll
    feavvgpaavalrsrnvdavaraaahlafdenhegaalpaditftafeasqgktprggrd
    gggkgaaggfeqrlasvmagdaalalesivsmavfdepptdisawplfegqdtaaarana
    vgaylaraaglvgamvfstnsalhltevddagpadpkdhskpsfyrfflvpgthvaanpq
    vdreghvvpgfegrptaplvggtqefagehlamlsgfspallakmlfylercdgavivgr
    qemdvfryvadsnqtdvpcnlctfdtrhacvhttlmrlrarhpkfasaargaigvfgtmn
    smysdcdvlgnyaafsalkradgsetartimqetyraatervmaeletlqyvdqavptam
    grletiitnrealhtvvnnvrqvvdreveqlmrnlvegrnfkfrdglgeanhamsltldp
    yacgpcpllqllgrrsnlavyqdlalsqchgvfagqsvegrnfrnqfqpvlrrrvmdmfn
    ngflsaktltvalsegaaicapsltagqtapaessfegdvarvtlgfpkelrvksrvlfa
    gasanaseaakarvaslqsayqkpdkrvdillgplgfllkqfhaaifpngkppgsnqpnp
    qwfwtalqrnqlparllsredietiafikkfsldygainfinlapnnvselamyymanqi
    lrycdhstyfintltaiiagsrrppsvqaaaawsaqggagleagaralmdavdahpgawt
    smfascnllrpvmaarpmvvlglsiskyygmagndrvfqagnwaslmggknacpllifdr
    trkfvlacpragfvcaasslgggahesslceqlrgiiseggaavassvfvatvkslgprt
    qqlqiedwlalledeylseemmeltaralergngewstdaalevaheaealvsqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urjB (B:)
    ttikvppgplgyvyaracpsegiellallsarsgdsdvavaplvvgltvesgfeanvavv
    vgsrttavslkltpshysssvyvfhggrhldpstqapnltrlcerarrhfgfsdytprpg
    dlkhettgealcerlgldpdrallylvvtegfkeavcinntflhlggsdkvtiggaevhr
    ipvyplqlfmpdfsrviaepfnanhrsigekftyplpffnrplnrllfeavvgpaavalr
    srnvdavaraaahlafdenhegaalpaditftafggfeqrlasvmagdaalalesivsma
    vfdepptdisawplfegqdtaaaranavgaylaraaglvgamvfstnsalhltevddagp
    ahskpsfyrfflvpgthvaanpqvdreghvvpgfegrptaplvggtqefagehlamlsgf
    spallakmlfylercdgavivmdvfryvadsnqtdvpcnlctfdtrhacvhttlmrlrar
    hpkfasaargaigvfgtmnsmysdcdvlgnyaetyraatervmaeletlqyvdqavptam
    grletiitnrealhtvvnnvrqvvdreveqlmrnlvefkfrdglgeanhamsltldpyac
    gpcpllqllgrrsnlavyqdlalsqchgvfagqsvegrnfrnqfqpvlrrrvmdmfnngf
    lsaktltvalsegaaicapsltagqtapaessfegdvarvtlgfpkelrvksrvlfsayq
    kpdkrvdillgplgfllkqfhaaifpngkppgsnqpnpqwfwtalqrnqlparllsredi
    etiafikkfsldygainfinlapnnvselamyymanqilrycdhstyfintltaiiagsr
    rppsvqaaaawsaqggagleagaralmdavdahpgawtsmfascnllrpvmaarpmvvlg
    lsiskyvfqagnwaslmggknacpllifdrtrkfvlacpragfvcaasslceqlrgiise
    ggaavassvfvatvkslgprtqqlqiedwlalledeylseemmeltaralergngewstd
    aalevaheaea