PDB entry 1uri

View 1uri on RCSB PDB site
Description: azurin mutant with met 121 replaced by gln
Class: electron transport
Keywords: electron transport, copper, periplasmic, signal
Deposited on 1996-11-14, released 1997-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (120)
    Domains in SCOPe 2.06: d1uria_
  • Chain 'B':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (120)
    Domains in SCOPe 2.06: d1urib_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uriA (A:)
aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
qkgtlklsn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uriB (B:)
aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
qkgtlklsn